Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVA1B, Human (Cell-Free, His)

EVA1B Protein, Human (Cell-Free, His) is the recombinant human-derived EVA1B protein, expressed by E. coli Cell-free, with N-10*His labeled tag.

Product Specifications

Product Name Alternative

EVA1B Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Smiles

MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPRGPAQRRDPRSSTLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVFTSAEELERAQRLEERERILREIWRTGQPDLLGTGTLGPSPTATGTLGRMHYY

Molecular Formula

55194 (Gene_ID) Q9NVM1 (M1-Y165) (Accession)

Molecular Weight

24.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coro1a Mouse Gene Knockout Kit (CRISPR)
KN503702 1 Kit

Coro1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD56 (NCAM1) (C-term) Rabbit Polyclonal Antibody
AP23280PU-N 100 µg

CD56 (NCAM1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FastClick™ 5-FAM Azide
72710-AAT 1 mg

FastClick™ 5-FAM Azide

Sign In for Pricing
View Details
HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI5D11]
CF810894 100 µg

HNRPH1 (HNRNPH1) Mouse Monoclonal Antibody [Clone ID: OTI5D11]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-,  40nm
GP-1802-40 1 mL

Colloidal Gold Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-, 40nm

Sign In for Pricing
View Details
THUMPD3 (NM_001114092) Human Recombinant Protein
TP325871M 100 µg

THUMPD3 (NM_001114092) Human Recombinant Protein

Sign In for Pricing
View Details