Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVA1B, Human (Cell-Free, His)

EVA1B Protein, Human (Cell-Free, His) is the recombinant human-derived EVA1B protein, expressed by E. coli Cell-free, with N-10*His labeled tag.

Product Specifications

Product Name Alternative

EVA1B Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Smiles

MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPRGPAQRRDPRSSTLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVFTSAEELERAQRLEERERILREIWRTGQPDLLGTGTLGPSPTATGTLGRMHYY

Molecular Formula

55194 (Gene_ID) Q9NVM1 (M1-Y165) (Accession)

Molecular Weight

24.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS803843 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
(3-Carboxypropyl)triphenylphosphonium Bromide
TRC-C181500-50G 50 g

(3-Carboxypropyl)triphenylphosphonium Bromide

Sign In for Pricing
View Details
Triflusulfuron
TRC-T782005-25MG 25 mg

Triflusulfuron

Sign In for Pricing
View Details
Recombinant RAVER2 Antibody
RC-5022-01 50 μL

Recombinant RAVER2 Antibody

Sign In for Pricing
View Details
Recombinant RAVER2 Antibody
RC-5022-02 100 µL

Recombinant RAVER2 Antibody

Sign In for Pricing
View Details
Recombinant RAVER2 Antibody
RC-5022-03 1 mL

Recombinant RAVER2 Antibody

Sign In for Pricing
View Details