Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR1, Mouse (Cell-Free, His)

CCR1 Protein, a C-C chemokine receptor, binds MIP-1-alpha, RANTES, and, to a lesser extent, MIP-1-beta or MCP-1, initiating signal transduction and elevating intracellular calcium levels. This receptor is crucial in modulating stem cell proliferation, regulating processes vital for tissue homeostasis and immune responses. CCR1's interaction with CREB3 suggests its involvement in complex signaling networks governing cellular functions. CCR1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CCR1 Protein, Mouse (Cell-Free, His) is 355 a.a., with molecular weight of 43.7 kDa.

Product Specifications

Product Name Alternative

CCR1 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Smiles

MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF

Molecular Formula

12768 (Gene_ID) P51675 (M1-F355) (Accession)

Molecular Weight

43.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOM1L2 (NM_001082968) Human Recombinant Protein
TP319271L 1 mg

TOM1L2 (NM_001082968) Human Recombinant Protein

Sign In for Pricing
View Details
IP1 Alkyne
20343-AAT 100 µg

IP1 Alkyne

Sign In for Pricing
View Details
Human RPUSD4 activation kit by CRISPRa
GA113736 1 Kit

Human RPUSD4 activation kit by CRISPRa

Sign In for Pricing
View Details
Loxoprofen-d3
TRC-L472907-2.5MG 2.5 mg

Loxoprofen-d3

Sign In for Pricing
View Details
SMAD3 Rabbit Polyclonal Antibody
AP08075PU-N 100 µL

SMAD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dihydro Isoferulic Acid-d3 3-O-Beta-D-Glucuronide
TRC-D448942-1MG 1 mg

Dihydro Isoferulic Acid-d3 3-O-Beta-D-Glucuronide

Sign In for Pricing
View Details