Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR1, Mouse (Cell-Free, His)

CCR1 Protein, a C-C chemokine receptor, binds MIP-1-alpha, RANTES, and, to a lesser extent, MIP-1-beta or MCP-1, initiating signal transduction and elevating intracellular calcium levels. This receptor is crucial in modulating stem cell proliferation, regulating processes vital for tissue homeostasis and immune responses. CCR1's interaction with CREB3 suggests its involvement in complex signaling networks governing cellular functions. CCR1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived CCR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CCR1 Protein, Mouse (Cell-Free, His) is 355 a.a., with molecular weight of 43.7 kDa.

Product Specifications

Product Name Alternative

CCR1 Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free

UNSPSC

12352202

Smiles

MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF

Molecular Formula

12768 (Gene_ID) P51675 (M1-F355) (Accession)

Molecular Weight

43.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (Pan Nuclear Marker) (N/A), CF640R conjugate, 0.1mg/mL
BNC401816-500 1x 500 µL

Histone H1 (Pan Nuclear Marker) (N/A), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-(2,3-Dichlorophenyl)piperazine 1-Oxide
TRC-D439260-25MG 25 mg

1-(2,3-Dichlorophenyl)piperazine 1-Oxide

Sign In for Pricing
View Details
IL9R Rabbit Polyclonal Antibody
AP20250PU-N 100 µg

IL9R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ITIH5 Human Gene Knockout Kit (CRISPR)
KN214478 1 Kit

ITIH5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,5-Dinitroanthraquinone
TRC-D473930-1G 1 g

1,5-Dinitroanthraquinone

Sign In for Pricing
View Details
PPP3CB (NM_001142354) Human Over-expression Lysate
LY428054 100 µg

PPP3CB (NM_001142354) Human Over-expression Lysate

Sign In for Pricing
View Details