ADORA1, Human (Cell-Free, His)
ADORA1 Protein, a receptor for adenosine, inhibits adenylyl cyclase through G proteins, modulating cellular activity. ADORA1 Protein, Human (Cell-Free, His) is the recombinant human-derived ADORA1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ADORA1 Protein, Human (Cell-Free, His) is 326 a.a., with molecular weight of 39.3 kDa.
Product Specifications
Product Name Alternative
ADORA1 Protein, Human (Cell-Free, His), Human, E. coli Cell-free
UNSPSC
12352202
Purity
90.00
Smiles
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
Molecular Formula
134 (Gene_ID) P30542 (M1-D326) (Accession)
Molecular Weight
Monomer: 36 kDa; Dimer: 80 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog