Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA1, Human (Cell-Free, His)

ADORA1 Protein, a receptor for adenosine, inhibits adenylyl cyclase through G proteins, modulating cellular activity. ADORA1 Protein, Human (Cell-Free, His) is the recombinant human-derived ADORA1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ADORA1 Protein, Human (Cell-Free, His) is 326 a.a., with molecular weight of 39.3 kDa.

Product Specifications

Product Name Alternative

ADORA1 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Purity

90.00

Smiles

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD

Molecular Formula

134 (Gene_ID) P30542 (M1-D326) (Accession)

Molecular Weight

Monomer: 36 kDa; Dimer: 80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP104 Antibody
KC-23339-01 50 μL

CEP104 Antibody

Sign In for Pricing
View Details
CEP104 Antibody
KC-23339-02 100 µL

CEP104 Antibody

Sign In for Pricing
View Details
CEP104 Antibody
KC-23339-03 1 mL

CEP104 Antibody

Sign In for Pricing
View Details
endo-alpha-Hydroxy-alpha-phenylbenzeneacetic Acid 8-Azabicyclo[3.2.1]oct-3-yl Ester Hydrochloride
TRC-H950150-250MG 250 mg

endo-alpha-Hydroxy-alpha-phenylbenzeneacetic Acid 8-Azabicyclo[3.2.1]oct-3-yl Ester Hydrochloride

Sign In for Pricing
View Details
Gastrin Releasing Peptide (GRP) Human qPCR Primer Pair (NM_002091)
HP234410 200 Reactions

Gastrin Releasing Peptide (GRP) Human qPCR Primer Pair (NM_002091)

Sign In for Pricing
View Details
p57 Kip2 (CDKN1C) (NM_000076) Human Over-expression Lysate
LC424941 20 µg

p57 Kip2 (CDKN1C) (NM_000076) Human Over-expression Lysate

Sign In for Pricing
View Details