Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAG-1/CCL4L1, Human

LAG-1/CCL4L1 protein acts as a chemokine and can induce chemotaxis in cells expressing CCR5 or CCR1, indicating its role in cell migration (chemotaxis) . Furthermore, it demonstrated the ability to inhibit HIV replication, particularly in CCR5-expressing peripheral blood mononuclear cells, suggesting a potential impact on antiviral defense mechanisms. LAG-1/CCL4L1 Protein, Human is the recombinant human-derived LAG-1/CCL4L1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

LAG-1/CCL4L1 Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN

Molecular Formula

388372 (Gene_ID) Q8NHW4-1 (A24-N92) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WNT4 / Protein Wnt-4 Recombinant Protein
R2978h 1 Each

Human WNT4 / Protein Wnt-4 Recombinant Protein

Sign In for Pricing
View Details
2-Chlorooxazolo[5,4-b]pyridine
OR916520-01 250 mg

2-Chlorooxazolo[5,4-b]pyridine

Sign In for Pricing
View Details
2-Chlorooxazolo[5,4-b]pyridine
OR916520-02 1 g

2-Chlorooxazolo[5,4-b]pyridine

Sign In for Pricing
View Details
PARP1 Rabbit Polyclonal Antibody
TA321381 100 µL

PARP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM27 sgRNA CRISPR Lentivector set (Human)
K2388201 3x 1.0 µg

TMEM27 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
BAY 41-2272 25mg
A15891-25 25 mg

BAY 41-2272 25mg

Sign In for Pricing
View Details