LAG-1/CCL4L1, Human
LAG-1/CCL4L1 protein acts as a chemokine and can induce chemotaxis in cells expressing CCR5 or CCR1, indicating its role in cell migration (chemotaxis) . Furthermore, it demonstrated the ability to inhibit HIV replication, particularly in CCR5-expressing peripheral blood mononuclear cells, suggesting a potential impact on antiviral defense mechanisms. LAG-1/CCL4L1 Protein, Human is the recombinant human-derived LAG-1/CCL4L1 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
LAG-1/CCL4L1 Protein, Human, Human, E. coli
UNSPSC
12352202
Purity
95.00
Smiles
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Molecular Formula
388372 (Gene_ID) Q8NHW4-1 (A24-N92) (Accession)
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
NUP50, CT (Nucleoporin 50kD, NUP50 Protein, NUP50, HCG1989366, isoform CRA_c, CTA-268H5.7-002) (MaxLight 550)
NUP50, CT (Nucleoporin 50kD, NUP50 Protein, NUP50, HCG1989366, isoform CRA_c, CTA-268H5.7-002) (MaxLight 550)
PSMD6 (26S Proteasome Non-ATPase Regulatory Subunit 6)