Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein A/G, Staphylococcus aureus

Product Specifications

Product Name Alternative

Protein A/G Protein, Staphylococcus aureus, Staphylococcus aureus, E. coli

UNSPSC

12352202

Smiles

NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDSLEGSGSGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE

Molecular Formula

/ (Gene_ID) P02976 (N35-D330) &P19909 (L298-E497) (Accession)

Molecular Weight

Approximately 47.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sall3 qPCR Primer Pair
QM21558S 200 Tests

Mouse Sall3 qPCR Primer Pair

Sign In for Pricing
View Details
CIRBP Antibody HRP Conjugated
MBS9461840-01 0.1 mL

CIRBP Antibody HRP Conjugated

Sign In for Pricing
View Details
CIRBP Antibody HRP Conjugated
MBS9461840-02 5x 0.1 mL

CIRBP Antibody HRP Conjugated

Sign In for Pricing
View Details
BAY-593
C01993-1mg 1 mg

BAY-593

Sign In for Pricing
View Details
RRAS2 Polyclonal Antibody
MBS2527524-01 0.02 mL

RRAS2 Polyclonal Antibody

Sign In for Pricing
View Details
RRAS2 Polyclonal Antibody
MBS2527524-02 0.06 mL

RRAS2 Polyclonal Antibody

Sign In for Pricing
View Details