Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2B, Rhesus Macaque (HEK293)

ACVR2B is a type II member of the TGF-β family of receptor Serine/Threonine kinases. ACVR2B binds to activins and growth differentiation factors (GDF), which in turn activate type I receptors, activating downstream molecule SMAD2/3[1]. ACVR2B Protein, Rhesus Macaque (HEK293) is produced in HEK293 cells.

Product Specifications

Product Name Alternative

ACVR2B Protein, Rhesus Macaque (HEK293), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acvr2b-protein-cynomolgus-hek293.html

Purity

97.0

Smiles

SGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTALEVLFQ

Molecular Formula

/ (Gene_ID) EHH16502.1 (S28-T118) (Accession)

Molecular Weight

Approximately 34 kDa

References & Citations

[1]Johanna Magga, et al. Systemic Blockade of ACVR2B Ligands Protects Myocardium from Acute Ischemia-Reperfusion Injury. Mol Ther. 2019 Mar 6;27 (3) :600-610.|[2]Oddrun Elise Olsen, et al. Activin A inhibits BMP-signaling by binding ACVR2A and ACVR2B. Cell Commun Signal. 2015 Jun 6;13:27.|[3]Rafael Barreto, et al. ACVR2B/Fc counteracts chemotherapy-induced loss of muscle and bone mass. Sci Rep. 2017 Oct 31;7 (1) :14470.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATPase, H+/K+ Exchanging Alpha Polypeptide (ATP4a) ELISA Kit
EKL55731 96 Tests

Human ATPase, H+/K+ Exchanging Alpha Polypeptide (ATP4a) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal VSIG4 Antibody (202) [DyLight 405]
NBP2-90066V 0.1 mL

Rabbit Monoclonal VSIG4 Antibody (202) [DyLight 405]

Sign In for Pricing
View Details
GPBP1 (NM_001127236) Human Tagged ORF Clone Lentiviral Particle
RC225814L4V 200 µL

GPBP1 (NM_001127236) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human TNFAIP3-interacting protein 3 (TNIP3) ELISA Kit
KTE60197-01 48 Tests

Human TNFAIP3-interacting protein 3 (TNIP3) ELISA Kit

Sign In for Pricing
View Details
Human TNFAIP3-interacting protein 3 (TNIP3) ELISA Kit
KTE60197-02 96 Tests

Human TNFAIP3-interacting protein 3 (TNIP3) ELISA Kit

Sign In for Pricing
View Details
Human TNFAIP3-interacting protein 3 (TNIP3) ELISA Kit
KTE60197-03 5x 96 Tests

Human TNFAIP3-interacting protein 3 (TNIP3) ELISA Kit

Sign In for Pricing
View Details