Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Streptomyces Agar

Product Specifications

Certification

Non IVD

HS Code

3821 00 00

Storage Temperature

Temp 10°-30° C

Shelf Life

59

Shipping Temperature

Temp 10°-30° C

EAN Code

8902729137062

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM40 3'UTR GFP Stable Cell Line
TU076549 1.0 mL

TRIM40 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Anti-Human IgG3 - AcalephFluor568
CSA3551-01 100 µL

Mouse Anti-Human IgG3 - AcalephFluor568

Sign In for Pricing
View Details
Mouse Anti-Human IgG3 - AcalephFluor568
CSA3551-02 500 μL

Mouse Anti-Human IgG3 - AcalephFluor568

Sign In for Pricing
View Details
Mouse Anti-Human IgG3 - AcalephFluor568
CSA3551-03 1 mL

Mouse Anti-Human IgG3 - AcalephFluor568

Sign In for Pricing
View Details
Rabbit Polyclonal ICE1 Antibody [Janelia Fluor 549]
NBP2-32090JF549 0.1 mL

Rabbit Polyclonal ICE1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH
PP49310-01 1 mg

H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH

Sign In for Pricing
View Details