Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TCOF1 Knockout HEK293T cell line

Engineered clonal HEK293T cells with TCOF1 gene knockout, sequence confirmed.

Product Specifications

No additional specifications available.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAKα (phospho Ser204) Antibody
A8158-01 50 μL

PAKα (phospho Ser204) Antibody

Sign In for Pricing
View Details
PAKα (phospho Ser204) Antibody
A8158-02 100 µL

PAKα (phospho Ser204) Antibody

Sign In for Pricing
View Details
ACOT7 siRNA (Mouse)
CRM8136-01 15 nmol

ACOT7 siRNA (Mouse)

Sign In for Pricing
View Details
ACOT7 siRNA (Mouse)
CRM8136-02 30 nmol

ACOT7 siRNA (Mouse)

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details