Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clusterin/APOJ, Human (HEK293, Fc-His)

Clusterin/APOJ Protein, Human (HEK293, Fc-His) expresses in HEK293 with an Fc fragment and a His tag at the N-terminus. Apolipoprotein J (ApoJ) is involved in numerous physiological process important for lipid transportation, vascular smooth muscle cell differentiation, and has the potential for atherosclerosis[1].

Product Specifications

Product Name Alternative

Clusterin/APOJ Protein, Human (HEK293, Fc-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clusterin-apoj-protein-human-hek293-fc-his.html

Purity

97.43

Smiles

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Molecular Formula

1191 (Gene_ID) P10909-1 (D23-E449) (Accession)

Molecular Weight

Approximately (35-40) & (61-79) & (95-100) kD

References & Citations

[1]Yang N, et al. Apolipoprotein J: A New Predictor and Therapeutic Target in Cardiovascular Disease? Chin Med J (Engl) . 2015 Sep 20;128 (18) :2530-4.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL2-like 2 (CPTC-BCL2L2-2), CF405S conjugate, 0.1mg/mL
BNC042265-500 1x 500 µL

BCL2-like 2 (CPTC-BCL2L2-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF568 conjugate, 0.1mg/mL
BNC682400-100 1x 100 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details