Cystatin SN/CST1, Human (HEK293, His)
Cystatin SN (CST1) is a component of human saliva that is immunologically similar to cystatin S but exhibits distinct specificity due to sequence variation. Cystatin SN has an isoelectric point of 7.5 and is a potent inhibitor of papain and dipeptidyl peptidase I, superior to Cystatin S in these activities. Cystatin SN/CST1 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin SN/CST1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
Cystatin SN/CST1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cystatin-sn-cst1-protein-human-hek-293-his.html
Purity
97.30
Smiles
WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Molecular Formula
1469 (Gene_ID) P01037 (W21-S141) (Accession)
Molecular Weight
Approximately 17.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Lentiviral mouse Mars2 shRNA (UAS) - Lentiviral mouseMars2 shRNA (UAS, GFP) (25)
Mouse Alpha-1-acid glycoprotein 1 (ORM1) ELISA Kit
Mouse Alpha-1-acid glycoprotein 1 (ORM1) ELISA Kit