Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB1A, Human (His)

In the Hippo signaling pathway, MOB1A acts as an important activator to control organ size and suppress tumors by regulating proliferation and apoptosis. MOB1A participates in the kinase cascade together with STK3/MST2 and STK4/MST1 to phosphorylate and activate LATS1/2, thereby affecting YAP1 oncoprotein and WWTR1/TAZ. MOB1A Protein, Human (His) is the recombinant human-derived MOB1A protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MOB1A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mob1a-protein-human-his.html

Purity

95.00

Smiles

SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR

Molecular Formula

55233 (Gene_ID) Q9H8S9-1 (S2-R216) (Accession)

Molecular Weight

Approximately 28.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gigyf2 (NM_146112) Mouse Tagged ORF Clone
MG218968 10 µg

Gigyf2 (NM_146112) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Mmp9 (NM_013599) AAV Particle
MR226712A1V 250 µL

Mouse Mmp9 (NM_013599) AAV Particle

Sign In for Pricing
View Details
HTR1F Polyclonal Antibody
MBS9432285-01 0.05 mL

HTR1F Polyclonal Antibody

Sign In for Pricing
View Details
HTR1F Polyclonal Antibody
MBS9432285-02 0.1 mL

HTR1F Polyclonal Antibody

Sign In for Pricing
View Details
HTR1F Polyclonal Antibody
MBS9432285-03 5x 0.1 mL

HTR1F Polyclonal Antibody

Sign In for Pricing
View Details
RGD1307439 ORF Vector (Rat) (pORF)
39003016 1.0 µg DNA

RGD1307439 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details