Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB1A, Human (His)

In the Hippo signaling pathway, MOB1A acts as an important activator to control organ size and suppress tumors by regulating proliferation and apoptosis. MOB1A participates in the kinase cascade together with STK3/MST2 and STK4/MST1 to phosphorylate and activate LATS1/2, thereby affecting YAP1 oncoprotein and WWTR1/TAZ. MOB1A Protein, Human (His) is the recombinant human-derived MOB1A protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MOB1A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mob1a-protein-human-his.html

Purity

95.00

Smiles

SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR

Molecular Formula

55233 (Gene_ID) Q9H8S9-1 (S2-R216) (Accession)

Molecular Weight

Approximately 28.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Maleimidopropionylaminomethyl resin (200-400 mesh)
FM111716-01 1000 mg

3-Maleimidopropionylaminomethyl resin (200-400 mesh)

Sign In for Pricing
View Details
3-Maleimidopropionylaminomethyl resin (200-400 mesh)
FM111716-02 2000 mg

3-Maleimidopropionylaminomethyl resin (200-400 mesh)

Sign In for Pricing
View Details
3-Maleimidopropionylaminomethyl resin (200-400 mesh)
FM111716-03 5000 mg

3-Maleimidopropionylaminomethyl resin (200-400 mesh)

Sign In for Pricing
View Details
3-Maleimidopropionylaminomethyl resin (200-400 mesh)
FM111716-04 10000 mg

3-Maleimidopropionylaminomethyl resin (200-400 mesh)

Sign In for Pricing
View Details
GLT8D2 Antibody
E307427b 100 µg - 200 µL

GLT8D2 Antibody

Sign In for Pricing
View Details
CRYM CRISPRa sgRNA lentivector (set of three targets)(Rat)
16895126 3x 1.0µg DNA

CRYM CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details