Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN1B, Human (His)

The CDKN1B protein is a key cell cycle regulator that inhibits CDK2 when bound to cyclin A, thereby inhibiting G1 phase progression. It exhibits significant inhibitory effects on cyclin E- and cyclin A-CDK2 complexes. CDKN1B Protein, Human (His) is the recombinant human-derived CDKN1B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CDKN1B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cdkn1b-protein-human-his.html

Purity

95.0

Smiles

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

Molecular Formula

1027 (Gene_ID) P46527 (M1-T198) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD64 (10.1), 0.2mg/mL
BNUB2846-100 1x 100 µL

CD64 (10.1), 0.2mg/mL

Sign In for Pricing
View Details
CD117 (KIT/982), CF568 conjugate, 0.1mg/mL
BNC680982-500 1x 500 µL

CD117 (KIT/982), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human SERPINB1/PI2 Protein (Human Cells, His Tag)
PKSH032695-01 10 µg

Recombinant Human SERPINB1/PI2 Protein (Human Cells, His Tag)

Sign In for Pricing
View Details
Recombinant Human SERPINB1/PI2 Protein (Human Cells, His Tag)
PKSH032695-02 50 µg

Recombinant Human SERPINB1/PI2 Protein (Human Cells, His Tag)

Sign In for Pricing
View Details
N-Acetyl-D-glucosamine
TRC-A178000-10G 10 g

N-Acetyl-D-glucosamine

Sign In for Pricing
View Details
Recombinant ZNF217 Antibody
RC-16196-01 50 μL

Recombinant ZNF217 Antibody

Sign In for Pricing
View Details