Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN1B, Human (His)

The CDKN1B protein is a key cell cycle regulator that inhibits CDK2 when bound to cyclin A, thereby inhibiting G1 phase progression. It exhibits significant inhibitory effects on cyclin E- and cyclin A-CDK2 complexes. CDKN1B Protein, Human (His) is the recombinant human-derived CDKN1B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CDKN1B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cdkn1b-protein-human-his.html

Purity

95.0

Smiles

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

Molecular Formula

1027 (Gene_ID) P46527 (M1-T198) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM45 Polyclonal Antibody
E-AB-90697-01 60 µL

RBM45 Polyclonal Antibody

Sign In for Pricing
View Details
RBM45 Polyclonal Antibody
E-AB-90697-02 120 µL

RBM45 Polyclonal Antibody

Sign In for Pricing
View Details
RBM45 Polyclonal Antibody
E-AB-90697-03 200 µL

RBM45 Polyclonal Antibody

Sign In for Pricing
View Details
Cacna1d Mouse Monoclonal Antibody [Clone ID: N38/8]
75-080 100 µL

Cacna1d Mouse Monoclonal Antibody [Clone ID: N38/8]

Sign In for Pricing
View Details
Hemoglobin subunit gamma 2 (HBG2) (NM_000184) Human Over-expression Lysate
LY424880 100 µg

Hemoglobin subunit gamma 2 (HBG2) (NM_000184) Human Over-expression Lysate

Sign In for Pricing
View Details
NAlpha-Boc-L-histidine
TRC-B656225-10G 10 g

NAlpha-Boc-L-histidine

Sign In for Pricing
View Details