Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN1B, Human (His)

The CDKN1B protein is a key cell cycle regulator that inhibits CDK2 when bound to cyclin A, thereby inhibiting G1 phase progression. It exhibits significant inhibitory effects on cyclin E- and cyclin A-CDK2 complexes. CDKN1B Protein, Human (His) is the recombinant human-derived CDKN1B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CDKN1B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cdkn1b-protein-human-his.html

Purity

95.0

Smiles

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

Molecular Formula

1027 (Gene_ID) P46527 (M1-T198) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reversine (2-(4-Morpholinoanilino)-6-cyclohexylaminopurine)
MBS6116710-01 1 mg

Reversine (2-(4-Morpholinoanilino)-6-cyclohexylaminopurine)

Sign In for Pricing
View Details
Reversine (2-(4-Morpholinoanilino)-6-cyclohexylaminopurine)
MBS6116710-02 5 mg

Reversine (2-(4-Morpholinoanilino)-6-cyclohexylaminopurine)

Sign In for Pricing
View Details
Reversine (2-(4-Morpholinoanilino)-6-cyclohexylaminopurine)
MBS6116710-03 5x 5 mg

Reversine (2-(4-Morpholinoanilino)-6-cyclohexylaminopurine)

Sign In for Pricing
View Details
Anti-S100A12 antibody
STJ114373 100 µl

Anti-S100A12 antibody

Sign In for Pricing
View Details
MUM1L1 Protein Vector (Mouse) (pPM-C-His)
PV203041 500 ng

MUM1L1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
STAM2 peptide
orb218202-01 1 mg

STAM2 peptide

Sign In for Pricing
View Details