Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C, Human (116a.a, HEK293)

VEGF-C Protein, Human (116a.a, HEK293) functions in lymphangiogenesis, where it acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth and migration.

Product Specifications

Product Name Alternative

VEGF-C Protein, Human (116a.a, HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293.html

Purity

95.00

Smiles

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Formula

7424 (Gene_ID) P49767 (A112-R227) (Accession)

Molecular Weight

Approximately 16-19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Joukov V, et al. A novel vascular endothelial growth factor, VEGF-C, is a ligand for the Flt4 (VEGFR-3) and KDR (VEGFR-2) receptor tyrosine kinases. EMBO J. 1996 Jan 15;15 (2) :290-98.|[2]Tammela T, et al. Blocking VEGFR-3 suppresses angiogenic sprouting and vascular network formation Nature. 2008 Jul 31;454 (7204) :656-60.|[3]Le Bras B, et al. VEGF-C is a trophic factor for neural progenitors in the vertebrate embryonic brain. Nat Neurosci. 2006 Mar;9 (3) :340-8.|[4]Machnik A, et al. Macrophages regulate salt-dependent volume and blood pressure by a vascular endothelial growth factor-C-dependent buffering mechanism. Nat Med. 2009 May;15 (5) :545-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-500 1x 500 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (CD30/412), CF740 conjugate, 0.1mg/mL
BNC740412-100 1x 100 µL

CD30 (CD30/412), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2424), CF405S conjugate, 0.1mg/mL
BNC042424-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2424), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), CF594 conjugate, 0.1mg/mL
BNC941791-500 1x 500 µL

SOX2 (Transcription Factor) (SOX2/1791), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details