Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Apolipoprotein E (APOE)

Product Specifications

Product Name Alternative

Apo-E

Abbreviation

Recombinant Rhesus macaque APOE protein

Gene Name

APOE

UniProt

Q28502

Expression Region

19-295aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

KVEQPVEPETEPELRQQAEGQSGQPWELALGRFWDYLRWVQTLSEQVQEELLSPQVTQELTTLMDETMKELKAYKSELEEQLSPVAEETRARLSKELQAAQARLGADMEDVRSRLVQYRSEVQAMLGQSTEELRARLASHLRKLRKRLLRDADDLQKRLARLGPLVEQGRVRAATVGSLASQPLQERAQAKLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQISLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGASTAPVPSDNH

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

APOE is an apolipoprotein, a protein associating with lipid particles, that mainly functions in lipoprotein-mediated lipid transport between organs via the plasma and interstitial fluids. APOE is a core component of plasma lipoproteins and is involved in their production, conversion and clearance. Apolipoproteins are amphipathic molecules that interact both with lipids of the lipoprotein particle core and the aqueous environment of the plasma. As such, APOE associates with chylomicrons, chylomicron remnants, very low density lipoproteins (VLDL) and intermediate density lipoproteins (IDL) but shows a preferential binding to high-density lipoproteins (HDL) . It also binds a wide range of cellular receptors including the LDL receptor/LDLR, the LDL receptor-related proteins LRP1, LRP2 and LRP8 and the very low-density lipoprotein receptor/VLDLR that mediate the cellular uptake of the APOE-containing lipoprotein particles. Finally, APOE has also a heparin-binding activity and binds heparan-sulfate proteoglycans on the surface of cells, a property that supports the capture and the receptor-mediated uptake of APOE-containing lipoproteins by cells. A main function of APOE is to mediate lipoprotein clearance through the uptake of chylomicrons, VLDLs, and HDLs by hepatocytes. APOE is also involved in the biosynthesis by the liver of VLDLs as well as their uptake by peripheral tissues ensuring the delivery of triglycerides and energy storage in muscle, heart and adipose tissues. By participating in the lipoprotein-mediated distribution of lipids among tissues, APOE plays a critical role in plasma and tissues lipid homeostasis. APOE is also involved in two steps of reverse cholesterol transport, the HDLs-mediated transport of cholesterol from peripheral tissues to the liver, and thereby plays an important role in cholesterol homeostasis. First, it is functionally associated with ABCA1 in the biogenesis of HDLs in tissues. Second, it is enriched in circulating HDLs and mediates their uptake by hepatocytes. APOE also plays an important role in lipid transport in the central nervous system, regulating neuron survival and sprouting.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12938275/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

P4HA1 Antibody, HRP conjugated
A30545-50UG 50 µg

P4HA1 Antibody, HRP conjugated

Ask
View Details
FBX41 rabbit pAb
E28PT6494 100μl

FBX41 rabbit pAb

Ask
View Details
Recombinant Shewanella baltica Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1163997-01 0.02 mg (E-Coli)

Recombinant Shewanella baltica Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Shewanella baltica Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1163997-02 0.02 mg (Yeast)

Recombinant Shewanella baltica Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Shewanella baltica Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1163997-03 0.1 mg (E-Coli)

Recombinant Shewanella baltica Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Shewanella baltica Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1163997-04 0.1 mg (Yeast)

Recombinant Shewanella baltica Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details