Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL5/CD158f, Human (HEK293, Fc)

KIR2DL5/CD158f, present on NK cells, acts as a receptor for HLA-C alleles. Its inhibitory function finely tunes NK cell activity, preventing cell lysis by interacting with specific HLA-C molecules. This dynamic engagement contributes to the nuanced balance of inhibitory signals in the immune system, regulating NK cell responses to potential targets. KIR2DL5/CD158f Protein, Human (HEK293, Fc) is the recombinant human-derived KIR2DL5/CD158f protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

KIR2DL5/CD158f Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2dl5-cd158f-protein-human-hek293-fc.html

Purity

98.0

Smiles

HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH

Molecular Formula

57292 (Gene_ID) Q8N109/NP_065396.1 (H22-H240) (Accession)

Molecular Weight

Approximately 65 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse E-Selectin ELISA Kit
SEKM-0213-01 48 Tests

Mouse E-Selectin ELISA Kit

Sign In for Pricing
View Details
Mouse E-Selectin ELISA Kit
SEKM-0213-02 96 Tests

Mouse E-Selectin ELISA Kit

Sign In for Pricing
View Details
Pira6 3'UTR GFP Stable Cell Line
TU166413 1.0 mL

Pira6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
AAS Platinum Std 1M HCI 1000ppm - 500ML
AAPTH 500 mL

AAS Platinum Std 1M HCI 1000ppm - 500ML

Sign In for Pricing
View Details
Recombinant Escherichia coli RepFIB replication protein A (repA)
MBS1377090-01 0.02 mg (E-Coli)

Recombinant Escherichia coli RepFIB replication protein A (repA)

Sign In for Pricing
View Details
Recombinant Escherichia coli RepFIB replication protein A (repA)
MBS1377090-02 0.02 mg (Yeast)

Recombinant Escherichia coli RepFIB replication protein A (repA)

Sign In for Pricing
View Details