Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLCA2 (NM_006536) Human Mass Spec Standard
PH307731 10 µg

CLCA2 (NM_006536) Human Mass Spec Standard

Sign In for Pricing
View Details
LCP1 discontinued
391050 200 µL

LCP1 discontinued

Sign In for Pricing
View Details
Human FIG4 Protein Lysate
MBS8411785-01 0.02 mg

Human FIG4 Protein Lysate

Sign In for Pricing
View Details
Human FIG4 Protein Lysate
MBS8411785-02 5x 0.02 mg

Human FIG4 Protein Lysate

Sign In for Pricing
View Details
Ctse 3'UTR Luciferase Stable Cell Line
TU202939 1.0 mL

Ctse 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monoclonal antibody to Legionella pneumonia conjugate
MBS596270-01 1 mg

Monoclonal antibody to Legionella pneumonia conjugate

Sign In for Pricing
View Details