Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcmt1 3'UTR GFP Stable Cell Line
TU265942 1.0 mL

Pcmt1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Gadd45b shRNA (UAS) - Lentiviral mouseGadd45b shRNA (UAS, GFP) (25)
GTR15203156 1 Vial

Lentiviral mouse Gadd45b shRNA (UAS) - Lentiviral mouseGadd45b shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Fas Rat Pre-designed siRNA Set A
HY-RS23147 1 Set

Fas Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Phospho-DAPK3 (T265) antibody
STJ90708 200 µl

Anti-Phospho-DAPK3 (T265) antibody

Sign In for Pricing
View Details
SIRT3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
43808124 3x 1.0µg DNA

SIRT3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Hordenine
MBS3608755-01 2 mg

Hordenine

Sign In for Pricing
View Details