Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FAM3B Protein
E30P1716 20 µg

Recombinant Human FAM3B Protein

Sign In for Pricing
View Details
CHO Monoclonal CRACC/SLAMF7 Antibody (elotuzumab) - Humanized - (Dry Ice)
NBP3-28172-100ug 100 µg

CHO Monoclonal CRACC/SLAMF7 Antibody (elotuzumab) - Humanized - (Dry Ice)

Sign In for Pricing
View Details
Prostate Specific Antigen, Total (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, γ-Seminoprotein, P-30 antigen, KLK3) (APC) discontinued
P9054-30-APC 100 µL

Prostate Specific Antigen, Total (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, γ-Seminoprotein, P-30 antigen, KLK3) (APC) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal V-type proton ATPase subunit F Antibody (OTI1B8) [Alexa Fluor 700]
NBP2-74863AF700 0.1 mL

Mouse Monoclonal V-type proton ATPase subunit F Antibody (OTI1B8) [Alexa Fluor 700]

Sign In for Pricing
View Details
Ghr ORF Vector (Rat) (pORF)
ORF067530 1.0 µg DNA

Ghr ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
OTX1 Rabbit Monoclonal Antibody
E49Y5220 100 µL

OTX1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details