Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFI1B (NM_004188) Human Tagged ORF Clone Lentiviral Particle
RC219503L4V 200 µL

GFI1B (NM_004188) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Defb29 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6327805 3x 1.0 µg

Defb29 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ZFP106 Antibody
E38PA2757 100 µL

ZFP106 Antibody

Sign In for Pricing
View Details
Claudin 3 (CLDN3) (NM_001306) Human Recombinant Protein
TP304882 20 µg

Claudin 3 (CLDN3) (NM_001306) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbi! anti-ATMIN Antibody, Affinity Purified
A303-398A-T 10 µg

Rabbi! anti-ATMIN Antibody, Affinity Purified

Sign In for Pricing
View Details
Human Pax4 Affinity Purified Polyclonal Ab
AF2614 100 µg

Human Pax4 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details