Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Troponin I Type 1 (slow skeletal) Antibody
NBP1-56642 100 µL

Rabbit Polyclonal Troponin I Type 1 (slow skeletal) Antibody

Sign In for Pricing
View Details
Mouse Tob1 Pre-designed siRNA Set A
SI115068A 1 Each

Mouse Tob1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
BIN1 (NM_139343) Human Tagged Lenti ORF Clone
RC214216L1 10 µg

BIN1 (NM_139343) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RON (MST1R) Rabbit Polyclonal Antibody
TA347339 100 µg

RON (MST1R) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Prl6a1 shRNA (UAS) - Lentiviral mouse Prl6a1 shRNA (UAS, iRFP) (100)
GTR15162615 1 Vial

Lentiviral mouse Prl6a1 shRNA (UAS) - Lentiviral mouse Prl6a1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Entasobulin 25mg
A21027-25 25 mg

Entasobulin 25mg

Sign In for Pricing
View Details