Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Cullin 2 antibody
SL4209R-01 50 µL

Rabbit Anti-Cullin 2 antibody

Sign In for Pricing
View Details
Rabbit Anti-Cullin 2 antibody
SL4209R-02 100 µL

Rabbit Anti-Cullin 2 antibody

Sign In for Pricing
View Details
RUSC1 Antibody
MBS151353-01 0.1 mg

RUSC1 Antibody

Sign In for Pricing
View Details
RUSC1 Antibody
MBS151353-02 5x 0.1 mg

RUSC1 Antibody

Sign In for Pricing
View Details
Ubxn2b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
49065114 3x 1.0 µg

Ubxn2b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Phospholipase C beta 3 (PLCB3) Human shRNA Plasmid Kit (Locus ID 5331)
TL310375 1 Kit

Phospholipase C beta 3 (PLCB3) Human shRNA Plasmid Kit (Locus ID 5331)

Sign In for Pricing
View Details