Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesis Luer Lock Needle; 115mm; 18G - PK5
CHR1729 5 / PCK

Kinesis Luer Lock Needle; 115mm; 18G - PK5

Sign In for Pricing
View Details
C2orf46 AAV siRNA Pooled Vector
53772161 1.0 µg

C2orf46 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Chicken Pyruvate Kinase (PK) ELISA Kit
YP-W69676-01 48 Tests

Chicken Pyruvate Kinase (PK) ELISA Kit

Sign In for Pricing
View Details
Chicken Pyruvate Kinase (PK) ELISA Kit
YP-W69676-02 96 Tests

Chicken Pyruvate Kinase (PK) ELISA Kit

Sign In for Pricing
View Details
PDE1B (NM_001288768) Human Untagged Clone
SC335865 10 µg

PDE1B (NM_001288768) Human Untagged Clone

Sign In for Pricing
View Details
Human Myosin light chain 3, MYL3 ELISA KIT
ELI-04534h 96 Tests

Human Myosin light chain 3, MYL3 ELISA KIT

Sign In for Pricing
View Details