Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-33 (Interleukin 33) ELISA Kit
EKF58546 96 Tests

Mouse IL-33 (Interleukin 33) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human SPATA25 shRNA (UAS) - Lentiviral human SPATA25 shRNA (UAS, RFP) (100)
GTR15096120 1 Vial

Lentiviral human SPATA25 shRNA (UAS) - Lentiviral human SPATA25 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Tns2 Mouse Gene Knockout Kit (CRISPR)
KN517405 1 Kit

Tns2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZFR CRISPR/Cas9 KO Plasmid (h)
sc-407242 20 µg

ZFR CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Human Complement C1q Tumor Necrosis Factor-Related Protein 1 (C1QTNF1) CLIA Kit
abx495830-01 96 Tests

Human Complement C1q Tumor Necrosis Factor-Related Protein 1 (C1QTNF1) CLIA Kit

Sign In for Pricing
View Details
Human Complement C1q Tumor Necrosis Factor-Related Protein 1 (C1QTNF1) CLIA Kit
abx495830-02 5x 96 Tests

Human Complement C1q Tumor Necrosis Factor-Related Protein 1 (C1QTNF1) CLIA Kit

Sign In for Pricing
View Details