Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOK3 Protein Vector (Human) (pPM-C-HA)
PV012935 500 ng

DOK3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SLC39A13 (Solute Carrier Family 39 Member 13, LIV-1 Subfamily of ZIP Zinc Transporter 9, LZT-Hs9, Zinc Transporter ZIP13, Zrt- and Irt-like Protein 13, ZIP13, ZIP-13) (MaxLight 650)
133486-ML650 100 µL

SLC39A13 (Solute Carrier Family 39 Member 13, LIV-1 Subfamily of ZIP Zinc Transporter 9, LZT-Hs9, Zinc Transporter ZIP13, Zrt- and Irt-like Protein 13, ZIP13, ZIP-13) (MaxLight 650)

Sign In for Pricing
View Details
SHF Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
43709064 1.0 µg DNA

SHF Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PTPRO Human Pre-designed siRNA Set A
HY-RS11446 1 Set

PTPRO Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rat Rnf39 Pre-designed siRNA Set B
SI212062B 1 Each

Rat Rnf39 Pre-designed siRNA Set B

Sign In for Pricing
View Details
TMPRSS6 Peptide - N-terminal region
MBS3236134-01 0.1 mg

TMPRSS6 Peptide - N-terminal region

Sign In for Pricing
View Details