Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CD152 Antibody (RPE)
GWB-5DD80C 100 Tests

Rat CD152 Antibody (RPE)

Sign In for Pricing
View Details
C5orf22 (NM_018356) Human Untagged Clone
SC113568 10 µg

C5orf22 (NM_018356) Human Untagged Clone

Sign In for Pricing
View Details
Mouse RELN (Reelin) ELISA Kit
RE2380M-01 48 Tests

Mouse RELN (Reelin) ELISA Kit

Sign In for Pricing
View Details
Mouse RELN (Reelin) ELISA Kit
RE2380M-02 96 Tests

Mouse RELN (Reelin) ELISA Kit

Sign In for Pricing
View Details
Trpc3 sgRNA CRISPR Lentivector set (Mouse)
K5020201 3x 1.0 µg

Trpc3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
FRG2 (NM_001005217) Human Over-expression Lysate
LS448831-100ug 100 µg

FRG2 (NM_001005217) Human Over-expression Lysate

Sign In for Pricing
View Details