Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACCN2 (ASIC1) (NM_001095) Human Tagged Lenti ORF Clone
RC217623L3 10 µg

ACCN2 (ASIC1) (NM_001095) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MTP18 (MTFP1) Human Gene Knockout Kit (CRISPR)
KN405922 1 Kit

MTP18 (MTFP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BORA siRNA (Rat)
CRR5021-01 15 nmol

BORA siRNA (Rat)

Sign In for Pricing
View Details
BORA siRNA (Rat)
CRR5021-02 30 nmol

BORA siRNA (Rat)

Sign In for Pricing
View Details
Znhit6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7559307 1.0 µg DNA

Znhit6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
PRKDC, NT (DNA-dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, HYRC, HYRC1) (MaxLight 650) discontinued
P9003-01D-ML650 100 µL

PRKDC, NT (DNA-dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, HYRC, HYRC1) (MaxLight 650) discontinued

Sign In for Pricing
View Details