Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSBPL6 (NM_032523) Human Tagged ORF Clone
RC213081 10 µg

OSBPL6 (NM_032523) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse Mastermind-like domain-containing protein 1 (Mamld1) , partial
MBS955903 Inquire

Recombinant Mouse Mastermind-like domain-containing protein 1 (Mamld1) , partial

Sign In for Pricing
View Details
Thymidylate Kinase (DTYMK) Human ELISA Kit
H5988 96 Tests

Thymidylate Kinase (DTYMK) Human ELISA Kit

Sign In for Pricing
View Details
WFDC5 3'UTR Lenti-reporter-Luc Vector
50408081 1.0 µg

WFDC5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Pulmonary Microvascular Endothelial Cells
RPC-484 5x 10^5

Mouse Pulmonary Microvascular Endothelial Cells

Sign In for Pricing
View Details
Listeria moncytogenes
bsm-72290M 100 µg

Listeria moncytogenes

Sign In for Pricing
View Details