Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

l7Rn6 Protein Vector (Mouse) (pPB-C-His)
PV195670 500 ng

l7Rn6 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Nxf7 shRNA (UAS) - Lentiviral mouse Nxf7 shRNA (UAS, RFP) (25)
GTR15171839 1 Vial

Lentiviral mouse Nxf7 shRNA (UAS) - Lentiviral mouse Nxf7 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Human VSIG2 protein (C-6His)
CD00673-01 10 µg

Recombinant Human VSIG2 protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human VSIG2 protein (C-6His)
CD00673-02 50 µg

Recombinant Human VSIG2 protein (C-6His)

Sign In for Pricing
View Details
CCR11 (ACKR4) (NM_178445) Human Tagged Lenti ORF Clone
RC224197L4 10 µg

CCR11 (ACKR4) (NM_178445) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2131096-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details