Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-7005-3p miRNA Antagomir
abx889316-01 10 nmol

Mouse mmu-miR-7005-3p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-7005-3p miRNA Antagomir
abx889316-02 20 nmol

Mouse mmu-miR-7005-3p miRNA Antagomir

Sign In for Pricing
View Details
Human EM2 (Endomorphin 2) ELISA Kit
MBS8804181-01 48 Strip Well

Human EM2 (Endomorphin 2) ELISA Kit

Sign In for Pricing
View Details
Human EM2 (Endomorphin 2) ELISA Kit
MBS8804181-02 96 Strip Well

Human EM2 (Endomorphin 2) ELISA Kit

Sign In for Pricing
View Details
Human EM2 (Endomorphin 2) ELISA Kit
MBS8804181-03 5x 96 Strip Well

Human EM2 (Endomorphin 2) ELISA Kit

Sign In for Pricing
View Details
Human EM2 (Endomorphin 2) ELISA Kit
MBS8804181-04 10x 96 Strip Well

Human EM2 (Endomorphin 2) ELISA Kit

Sign In for Pricing
View Details