Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyms sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4952706 1.0 µg DNA

Tyms sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Fish Ras-Related Protein Rab-13 (RAB13) ELISA Kit
MBS9395881 Inquire

Fish Ras-Related Protein Rab-13 (RAB13) ELISA Kit

Sign In for Pricing
View Details
Casp12 (NM_009808) Mouse Tagged ORF Clone Lentiviral Particle
MR206636L3V 200 µL

Casp12 (NM_009808) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Z-Arg(NO2)-OH
5-07136 100 g

Z-Arg(NO2)-OH

Sign In for Pricing
View Details
Mouse UDP-Glucuronic Acid Decarboxylase 1 (UXS1) ELISA Kit
abx390825 96 Tests

Mouse UDP-Glucuronic Acid Decarboxylase 1 (UXS1) ELISA Kit

Sign In for Pricing
View Details
PBX1 Recombinant Rabbit Monoclonal Antibody [PSH0-24]
HA721303 100 µL

PBX1 Recombinant Rabbit Monoclonal Antibody [PSH0-24]

Sign In for Pricing
View Details