Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Peptide YY Antibody (1) [DyLight 550]
NBP1-05167R 0.1 mL

Mouse Monoclonal Peptide YY Antibody (1) [DyLight 550]

Sign In for Pricing
View Details
Dnmt2 Recombinant Protein Antigen
NBP2-47483PEP 0.1 mL

Dnmt2 Recombinant Protein Antigen

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) ISPE Polyclonal Antibody
MBS7175181 Inquire

Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) ISPE Polyclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase Rabbit mAb
E60M1451 100 µL

Alkaline Phosphatase Rabbit mAb

Sign In for Pricing
View Details
Human hnRNP U (HNRNPU) (NM_031844) AAV Particle
RC214320A1V 250 µL

Human hnRNP U (HNRNPU) (NM_031844) AAV Particle

Sign In for Pricing
View Details
Mouse Kidney Injury Molecule 1 (Kim1) CLIA Kit
EKN50027 96 Tests

Mouse Kidney Injury Molecule 1 (Kim1) CLIA Kit

Sign In for Pricing
View Details