Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)

Molecular Weight

40-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Atp13a1 shRNA (UAS) - Lentiviral mouse Atp13a1 shRNA (UAS) (25)
GTR15259829 1 Vial

Lentiviral mouse Atp13a1 shRNA (UAS) - Lentiviral mouse Atp13a1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Zfp386 qPCR Primer Pair
QM28226S 200 Tests

Mouse Zfp386 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Monoclonal Myelin PLP Antibody (plpc 1) [Biotin]
NB600-960B 0.1 mL

Mouse Monoclonal Myelin PLP Antibody (plpc 1) [Biotin]

Sign In for Pricing
View Details
Ccdc189 Rat shRNA Plasmid (Locus ID 691909)
TL708788 1 Kit

Ccdc189 Rat shRNA Plasmid (Locus ID 691909)

Sign In for Pricing
View Details
TPO Antibody / Thyroid Peroxidase
V8625SAF-100UG 100 µg

TPO Antibody / Thyroid Peroxidase

Sign In for Pricing
View Details
GABPB2 Protein Vector (Mouse) (pPM-C-His)
PV180901 500 ng

GABPB2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details