B7-H4, Rhesus macaque (HEK293, His)
B7-H4 Protein, Rhesus macaque (HEK293, His) may participate in negative regulation of cell-mediated immunity in peripheral tissues. Cell-associated B7-H4 could also inhibit T cell response. B7-H4 acts as a morphogenic factor for cancer cells[1][2][3].
Product Specifications
Product Name Alternative
B7-H4 Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-h4-protein-rhesus-macaque-hek293-his.html
Purity
95.0
Smiles
FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVIGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAHHHHHH
Molecular Formula
714123 (Gene_ID) F7B770 (F29-A258) (Accession)
Molecular Weight
40-60 kDa
References & Citations
[1]Gabriel L Sica, et al. B7-H4, a molecule of the B7 family, negatively regulates T cell immunity. Immunity. 2003 Jun;18 (6) :849-61.|[2]Joseph R Podojil, et al. Potential targeting of B7-H4 for the treatment of cancer. Immunol Rev. 2017 Mar;276 (1) :40-51.|[3]Yun Qian, et al. B7-H4 enhances oncogenicity and inhibits apoptosis in pancreatic cancer cells. Cell Tissue Res. 2013 Jul;353 (1) :139-51.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
27112156 3x 1.0 µg DNA
LOC303448 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
Sign In for Pricing
View Details MBS474599-01 0.1 mL
Sphingosine Kinase 1 (Ser-225), phospho-specific Antibody
Sign In for Pricing
View Details MBS474599-02 5x 0.1 mL
Sphingosine Kinase 1 (Ser-225), phospho-specific Antibody
Sign In for Pricing
View Details 
RC203180L1 10 µg
Cyclophilin B (PPIB) (NM_000942) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 253687-Biotin 100 µL
ZNF213 (Zinc Finger Protein 213, CR53, ZKSCAN21) (Biotin)
Sign In for Pricing
View Details