Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Human (Biotinylated, His-Avi)

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Human (Biotinylated, His-Avi), a Biotinylated IL-1 beta protein, is produced in E. coli with a C-Terminal His-tag and a C-Terminal Avi-tag. It consists of 153 amino acids (A117-S269) .

Product Specifications

Product Name Alternative

IL-1 beta Protein, Human (Biotinylated, His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-human-biotinylated-his-avi.html

Purity

95.0

Smiles

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Formula

3553 (Gene_ID) P01584 (A117-S269) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Phospho-FLT3 (Tyr591) antibody
SL3147R-01 50 µL

Rabbit Anti-Phospho-FLT3 (Tyr591) antibody

Sign In for Pricing
View Details
Rabbit Anti-Phospho-FLT3 (Tyr591) antibody
SL3147R-02 100 µL

Rabbit Anti-Phospho-FLT3 (Tyr591) antibody

Sign In for Pricing
View Details
Luciferin
PCT1557-1G 1 unit

Luciferin

Sign In for Pricing
View Details
Dendrin (DDN) Rat ELISA Kit
C8564 96 Tests

Dendrin (DDN) Rat ELISA Kit

Sign In for Pricing
View Details
CD152, Recombinant, Human, aa36-161, His-Tag (CTLA-4)
052062 50 µg

CD152, Recombinant, Human, aa36-161, His-Tag (CTLA-4)

Sign In for Pricing
View Details
OR6P1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1529902 1.0 µg DNA

OR6P1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details