Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Human (Biotinylated, His-Avi)

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Human (Biotinylated, His-Avi), a Biotinylated IL-1 beta protein, is produced in E. coli with a C-Terminal His-tag and a C-Terminal Avi-tag. It consists of 153 amino acids (A117-S269) .

Product Specifications

Product Name Alternative

IL-1 beta Protein, Human (Biotinylated, His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-human-biotinylated-his-avi.html

Purity

95.0

Smiles

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Formula

3553 (Gene_ID) P01584 (A117-S269) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Teclistamab ELISA Kit
DX959028 96 Tests

Teclistamab ELISA Kit

Sign In for Pricing
View Details
Human TACI/TNFRSF13B MAb (Clone 165609)
MAB174-SP 25 µg

Human TACI/TNFRSF13B MAb (Clone 165609)

Sign In for Pricing
View Details
GRIA4 Protein Vector (Rat) (pPB-N-His)
PV271503 500 ng

GRIA4 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
NuMA Antibody
E90527 100 µL

NuMA Antibody

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Lipoyl synthase (lipA)
MBS1330645-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Lipoyl synthase (lipA)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Lipoyl synthase (lipA)
MBS1330645-02 0.02 mg (Yeast)

Recombinant Shigella flexneri serotype 5b Lipoyl synthase (lipA)

Sign In for Pricing
View Details