Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Human (Biotinylated, His-Avi)

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Human (Biotinylated, His-Avi), a Biotinylated IL-1 beta protein, is produced in E. coli with a C-Terminal His-tag and a C-Terminal Avi-tag. It consists of 153 amino acids (A117-S269) .

Product Specifications

Product Name Alternative

IL-1 beta Protein, Human (Biotinylated, His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-human-biotinylated-his-avi.html

Purity

95.0

Smiles

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Formula

3553 (Gene_ID) P01584 (A117-S269) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apoptosis-enhancing nuclease (AEN) Human ELISA Kit
B6310 96 Tests

Apoptosis-enhancing nuclease (AEN) Human ELISA Kit

Sign In for Pricing
View Details
2-Amino-3,3,3-trifluoropropanoic acid hydrochloride
MBS9022876-01 1 g

2-Amino-3,3,3-trifluoropropanoic acid hydrochloride

Sign In for Pricing
View Details
2-Amino-3,3,3-trifluoropropanoic acid hydrochloride
MBS9022876-02 5x 1 g

2-Amino-3,3,3-trifluoropropanoic acid hydrochloride

Sign In for Pricing
View Details
TRAPPC6B Rabbit pAb
MBS8549968-01 0.1 mL

TRAPPC6B Rabbit pAb

Sign In for Pricing
View Details
TRAPPC6B Rabbit pAb
MBS8549968-02 0.1 mL (AF405L)

TRAPPC6B Rabbit pAb

Sign In for Pricing
View Details
TRAPPC6B Rabbit pAb
MBS8549968-03 0.1 mL (AF405S)

TRAPPC6B Rabbit pAb

Sign In for Pricing
View Details