Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 24 protein (CCL24), partial (Active)

Product Specifications

Product Name Alternative

CK-beta-6, Eotaxin-2, Myeloid progenitor inhibitory factor 2, MPIF-2, Small-inducible cytokine A24

Abbreviation

Recombinant Human CCL24 protein, partial (Active)

Gene Name

CCL24

UniProt

O00175

Expression Region

27-104aa

Organism

Homo sapiens (Human)

Target Sequence

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration of 50-100 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3.

Molecular Weight

8.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Apoptotic chromatin condensation inducer in the nucleus (ACIN1) ELISA Kit
MBS7232405-01 48 Well

Sheep Apoptotic chromatin condensation inducer in the nucleus (ACIN1) ELISA Kit

Sign In for Pricing
View Details
Sheep Apoptotic chromatin condensation inducer in the nucleus (ACIN1) ELISA Kit
MBS7232405-02 96 Well

Sheep Apoptotic chromatin condensation inducer in the nucleus (ACIN1) ELISA Kit

Sign In for Pricing
View Details
Sheep Apoptotic chromatin condensation inducer in the nucleus (ACIN1) ELISA Kit
MBS7232405-03 5x 96 Well

Sheep Apoptotic chromatin condensation inducer in the nucleus (ACIN1) ELISA Kit

Sign In for Pricing
View Details
Sheep Apoptotic chromatin condensation inducer in the nucleus (ACIN1) ELISA Kit
MBS7232405-04 10x 96 Well

Sheep Apoptotic chromatin condensation inducer in the nucleus (ACIN1) ELISA Kit

Sign In for Pricing
View Details
Gibberellin A5 (Standard)
HY-N9418R 1 Each

Gibberellin A5 (Standard)

Sign In for Pricing
View Details
Polyclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)
MBS2090508-01 0.1 mL

Polyclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)

Sign In for Pricing
View Details