Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpinb9g Mouse shRNA Lentiviral Particle (Locus ID 93806)
TL512631V 500 µL Each

Serpinb9g Mouse shRNA Lentiviral Particle (Locus ID 93806)

Sign In for Pricing
View Details
Rabbit anti-BIG2/ARFGEF2 IHC Antibody, Affinity Purified
IHC-00545 25 µg

Rabbit anti-BIG2/ARFGEF2 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
CABP1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62820R-BF350 100 µL

CABP1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Human SNUPN Protein Lysate
MBS8419948-01 0.02 mg

Human SNUPN Protein Lysate

Sign In for Pricing
View Details
Human SNUPN Protein Lysate
MBS8419948-02 5x 0.02 mg

Human SNUPN Protein Lysate

Sign In for Pricing
View Details
Fish glycogen (Gly) ELISA Kit
CK-bio-27600-01 48 Tests

Fish glycogen (Gly) ELISA Kit

Sign In for Pricing
View Details