Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin (HMW)
PR402 -3ml 3 mL

Cytokeratin (HMW)

Sign In for Pricing
View Details
R3HDM1 sgRNA CRISPR Lentivector set (Human)
K1767601 3x 1.0 µg

R3HDM1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
PINK1 Rabbit Polyclonal Antibody
MBS9459315-01 0.05 mL

PINK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PINK1 Rabbit Polyclonal Antibody
MBS9459315-02 0.1 mL

PINK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PINK1 Rabbit Polyclonal Antibody
MBS9459315-03 5x 0.1 mL

PINK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PHC1 Protein Vector (Mouse) (pPB-C-His)
PV215598 500 ng

PHC1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details