Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NPS (Neuropeptide S) ELISA Kit
EH25043 96 Tests

Human NPS (Neuropeptide S) ELISA Kit

Sign In for Pricing
View Details
IL-19 Antibody Pair [HRP]
NBP2-79408-15Plates 15 Plates

IL-19 Antibody Pair [HRP]

Sign In for Pricing
View Details
Polyclonal NMDA Receptor, NR2A Subunit Antibody
AMM06717G 0.1mg

Polyclonal NMDA Receptor, NR2A Subunit Antibody

Sign In for Pricing
View Details
IGFBP7 (NM_001553) Human Tagged ORF Clone Lentiviral Particle
RC209844L3V 200 µL

IGFBP7 (NM_001553) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human MAGEB2 Pre-designed siRNA Set B
SI009119B 1 Each

Human MAGEB2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
IL27 (Interleukin-27 Subunit alpha, IL-27 Subunit alpha, IL-27-A, IL27-A, p28, IL27A, MGC71873) (PE)
MBS6382771-01 0.1 mL

IL27 (Interleukin-27 Subunit alpha, IL-27 Subunit alpha, IL-27-A, IL27-A, p28, IL27A, MGC71873) (PE)

Sign In for Pricing
View Details