Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Pdcd1lg2 Protein, Fc-tagged, Alexa Fluor 555 conjugated
Pdcd1lg2-541RAF555 20 μg- 50 μg- 100 μg

Recombinant Rat Pdcd1lg2 Protein, Fc-tagged, Alexa Fluor 555 conjugated

Sign In for Pricing
View Details
IL2 Receptor alpha (IL2RA) Human qPCR Primer Pair (NM_000417)
HP200397 200 Reactions

IL2 Receptor alpha (IL2RA) Human qPCR Primer Pair (NM_000417)

Sign In for Pricing
View Details
Recombinant Rat CDNF
P6420-5μg 5 μg

Recombinant Rat CDNF

Sign In for Pricing
View Details
IdeS Protease
UA070027-01 500 U

IdeS Protease

Sign In for Pricing
View Details
IdeS Protease
UA070027-02 2 mg

IdeS Protease

Sign In for Pricing
View Details
IdeS Protease
UA070027-03 2000 U

IdeS Protease

Sign In for Pricing
View Details