Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANXA2 Protein Vector (Human) (pPM-N-D-C-HA)
PV322400 500 ng

ANXA2 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Protein Shroom2 (SHROOM2) Mouse ELISA Kit
G4163 96 Tests

Protein Shroom2 (SHROOM2) Mouse ELISA Kit

Sign In for Pricing
View Details
Protein Kinase N2 (PKN2) Recombinant, Mouse discontinued
156521-01 10 µg

Protein Kinase N2 (PKN2) Recombinant, Mouse discontinued

Sign In for Pricing
View Details
Protein Kinase N2 (PKN2) Recombinant, Mouse discontinued
156521-02 50 µg

Protein Kinase N2 (PKN2) Recombinant, Mouse discontinued

Sign In for Pricing
View Details
Porcine Monocyte Chemotactic Protein 1/Monocyte Chemotactic And Activating Factor ELISA Kit
BG-POR11567 1 Each

Porcine Monocyte Chemotactic Protein 1/Monocyte Chemotactic And Activating Factor ELISA Kit

Sign In for Pricing
View Details
Recombinant Orosomucoid 2 (ORM2)
MBS2009704-01 0.01 mg

Recombinant Orosomucoid 2 (ORM2)

Sign In for Pricing
View Details