Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pECMV-3×FLAG-Zfp219-m Plasmid
PVT20745 2 µg

pECMV-3×FLAG-Zfp219-m Plasmid

Sign In for Pricing
View Details
Egr3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3990604 1.0 µg DNA

Egr3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
RPS3AP42 3'UTR Luciferase Stable Cell Line
TU021769 1.0 mL

RPS3AP42 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DISC1 (NM_001164550) Human 3' UTR Clone
SC214863 10 µg

DISC1 (NM_001164550) Human 3' UTR Clone

Sign In for Pricing
View Details
Recombinant Human Parkinson disease protein 7 (PARK7), partial
CSB-EP860342HU2c0-01 20 µg

Recombinant Human Parkinson disease protein 7 (PARK7), partial

Sign In for Pricing
View Details
Recombinant Human Parkinson disease protein 7 (PARK7), partial
CSB-EP860342HU2c0-02 100 µg

Recombinant Human Parkinson disease protein 7 (PARK7), partial

Sign In for Pricing
View Details