Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRRM2 Polyclonal Antibody
BT-AP14486-01 20 µL

SRRM2 Polyclonal Antibody

Sign In for Pricing
View Details
SRRM2 Polyclonal Antibody
BT-AP14486-02 50 µL

SRRM2 Polyclonal Antibody

Sign In for Pricing
View Details
SRRM2 Polyclonal Antibody
BT-AP14486-03 100 µL

SRRM2 Polyclonal Antibody

Sign In for Pricing
View Details
STRN4 Protein Vector (Rat) (pPM-C-HA)
PV308744 500 ng

STRN4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RPL5P4 sgRNA CRISPR Lentivector (Human) (Target 3)
K1875304 1.0 µg DNA

RPL5P4 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Human SLC35G3 Protein, His (Fc)-Avi-tagged
SLC35G3-4075H 50 µg

Recombinant Human SLC35G3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details