Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Glucocorticoid Receptor, Gr Elisa Kit
EKC39103 96 Tests

Rat Glucocorticoid Receptor, Gr Elisa Kit

Sign In for Pricing
View Details
TSG-6 (h) : 293T Lysate
sc-114157 100 µg - 200 µL

TSG-6 (h) : 293T Lysate

Sign In for Pricing
View Details
Rat 25-Hydroxy vitamin D ELISA Kit
MBS726643-01 48 Well

Rat 25-Hydroxy vitamin D ELISA Kit

Sign In for Pricing
View Details
Rat 25-Hydroxy vitamin D ELISA Kit
MBS726643-02 96 Well

Rat 25-Hydroxy vitamin D ELISA Kit

Sign In for Pricing
View Details
Rat 25-Hydroxy vitamin D ELISA Kit
MBS726643-03 5x 96 Well

Rat 25-Hydroxy vitamin D ELISA Kit

Sign In for Pricing
View Details
Rat 25-Hydroxy vitamin D ELISA Kit
MBS726643-04 10x 96 Well

Rat 25-Hydroxy vitamin D ELISA Kit

Sign In for Pricing
View Details