Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heat Shock Protein Beta 6 (Biotin)
547402 200 µL

Heat Shock Protein Beta 6 (Biotin)

Sign In for Pricing
View Details
CD5, ID (CD5, LEU1, T-cell surface glycoprotein CD5, Lymphocyte antigen T1/Leu-1, CD5) (APC)
MBS6283325-01 0.2 mL

CD5, ID (CD5, LEU1, T-cell surface glycoprotein CD5, Lymphocyte antigen T1/Leu-1, CD5) (APC)

Sign In for Pricing
View Details
CD5, ID (CD5, LEU1, T-cell surface glycoprotein CD5, Lymphocyte antigen T1/Leu-1, CD5) (APC)
MBS6283325-02 5x 0.2 mL

CD5, ID (CD5, LEU1, T-cell surface glycoprotein CD5, Lymphocyte antigen T1/Leu-1, CD5) (APC)

Sign In for Pricing
View Details
AIPL1 Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI3B4]
TA700080 50 µg

AIPL1 Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI3B4]

Sign In for Pricing
View Details
PPP1R14BP2 3'UTR GFP Stable Cell Line
TU068665 1.0 mL

PPP1R14BP2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
hsa-miR-33a-5p miRNA Antagomir
MBS8315972-01 10 nmol

hsa-miR-33a-5p miRNA Antagomir

Sign In for Pricing
View Details