Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFV2 Rabbit Polyclonal Antibody
TA344742 100 µL

NDUFV2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXL2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-6633R-BF647 100 µL

FOXL2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
HECA Polyclonal Antibody, HRP Conjugated
bs-9702R-HRP 100 µL

HECA Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Anxa3 ORF Vector (Mouse) (pORF)
ORF038718 1.0 µg DNA

Anxa3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Polyclonal Antibody to S6 Ribosomal Protein (Ab-235/236)
35-1850-100 100 µL

Polyclonal Antibody to S6 Ribosomal Protein (Ab-235/236)

Sign In for Pricing
View Details
Magnesium bromide ethyl etherate
sc-255258 25 g

Magnesium bromide ethyl etherate

Sign In for Pricing
View Details