Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceratotoxin A
C2780A 1 mg

Ceratotoxin A

Sign In for Pricing
View Details
B3GALT2 (NM_003783) Human Tagged ORF Clone
RC205366 10 µg

B3GALT2 (NM_003783) Human Tagged ORF Clone

Sign In for Pricing
View Details
Urotensin-2 (UTS2) Antibody
abx320307-01 20 µL

Urotensin-2 (UTS2) Antibody

Sign In for Pricing
View Details
Urotensin-2 (UTS2) Antibody
abx320307-02 50 µL

Urotensin-2 (UTS2) Antibody

Sign In for Pricing
View Details
Urotensin-2 (UTS2) Antibody
abx320307-03 100 µL

Urotensin-2 (UTS2) Antibody

Sign In for Pricing
View Details
Urotensin-2 (UTS2) Antibody
abx320307-04 200 µL

Urotensin-2 (UTS2) Antibody

Sign In for Pricing
View Details