Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD6, ID (PSMD6, KIAA0107, PFAAP4, 26S proteasome non-ATPase regulatory subunit 6, 26S proteasome regulatory subunit RPN7, 26S proteasome regulatory subunit S10, Breast cancer-associated protein SGA-113M, Phosphonoformate immuno-associated protein 4, Proteasome regulatory particle subunit p44S10, p42A) (MaxLight 750) discontinued
040568-ML750 100 µL

PSMD6, ID (PSMD6, KIAA0107, PFAAP4, 26S proteasome non-ATPase regulatory subunit 6, 26S proteasome regulatory subunit RPN7, 26S proteasome regulatory subunit S10, Breast cancer-associated protein SGA-113M, Phosphonoformate immuno-associated protein 4, Proteasome regulatory particle subunit p44S10, p42A) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PAK4, Active, Recombinant, Human (pak-4, pak 4, Active PAK4, PDK4, human PDK4, active kinase, active kinases, PDK, recombinant PDK4, recombinant PDK, kinase activity assay, protein kinase) discontinued
167933 5 µg

PAK4, Active, Recombinant, Human (pak-4, pak 4, Active PAK4, PDK4, human PDK4, active kinase, active kinases, PDK, recombinant PDK4, recombinant PDK, kinase activity assay, protein kinase) discontinued

Sign In for Pricing
View Details
PRMT1 polyclonal antibody
BS91107 50ul

PRMT1 polyclonal antibody

Sign In for Pricing
View Details
ZBTB25, CT (ZBTB25, C14orf51, KUP, ZNF46, Zinc finger and BTB domain-containing protein 25, Zinc finger protein 46, Zinc finger protein KUP) (PE)
MBS6364588-01 0.2 mL

ZBTB25, CT (ZBTB25, C14orf51, KUP, ZNF46, Zinc finger and BTB domain-containing protein 25, Zinc finger protein 46, Zinc finger protein KUP) (PE)

Sign In for Pricing
View Details
ZBTB25, CT (ZBTB25, C14orf51, KUP, ZNF46, Zinc finger and BTB domain-containing protein 25, Zinc finger protein 46, Zinc finger protein KUP) (PE)
MBS6364588-02 5x 0.2 mL

ZBTB25, CT (ZBTB25, C14orf51, KUP, ZNF46, Zinc finger and BTB domain-containing protein 25, Zinc finger protein 46, Zinc finger protein KUP) (PE)

Sign In for Pricing
View Details
Rabbit Polyclonal eEF-2 Antibody
NB100-87020 0.1 mL

Rabbit Polyclonal eEF-2 Antibody

Sign In for Pricing
View Details