Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC286987 Protein Vector (Rat) (pPB-C-His)
PV278166 500 ng

LOC286987 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral human TUSC1 shRNA (UAS) - Lentiviral human TUSC1 shRNA (UAS, iRFP) (25)
GTR15160130 1 Vial

Lentiviral human TUSC1 shRNA (UAS) - Lentiviral human TUSC1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
[3- (3,5-Dimethyl-1H-pyrazol-1-yl) phenyl]boronic acid ≥95% (NMR)
231274-01 100 mg

[3- (3,5-Dimethyl-1H-pyrazol-1-yl) phenyl]boronic acid ≥95% (NMR)

Sign In for Pricing
View Details
[3- (3,5-Dimethyl-1H-pyrazol-1-yl) phenyl]boronic acid ≥95% (NMR)
231274-02 250 mg

[3- (3,5-Dimethyl-1H-pyrazol-1-yl) phenyl]boronic acid ≥95% (NMR)

Sign In for Pricing
View Details
[3- (3,5-Dimethyl-1H-pyrazol-1-yl) phenyl]boronic acid ≥95% (NMR)
231274-03 1 g

[3- (3,5-Dimethyl-1H-pyrazol-1-yl) phenyl]boronic acid ≥95% (NMR)

Sign In for Pricing
View Details
[3- (3,5-Dimethyl-1H-pyrazol-1-yl) phenyl]boronic acid ≥95% (NMR)
231274-04 5 g

[3- (3,5-Dimethyl-1H-pyrazol-1-yl) phenyl]boronic acid ≥95% (NMR)

Sign In for Pricing
View Details