Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Refrigerated Cooled Incubator Glass Door 340L
RLCG03401 1 Each

Refrigerated Cooled Incubator Glass Door 340L

Sign In for Pricing
View Details
Recombinant Human Xaa-Pro Aminopeptidase 1/XPNPEP1 (C-6His)
32-7171-10 10 µg

Recombinant Human Xaa-Pro Aminopeptidase 1/XPNPEP1 (C-6His)

Sign In for Pricing
View Details
Rabbit Polyclonal FUS Antibody [DyLight 550]
NB100-560R 0.1 mL

Rabbit Polyclonal FUS Antibody [DyLight 550]

Sign In for Pricing
View Details
Rabbit Anti-SPINK1 antibody
SLM-60323R-01 50 µL

Rabbit Anti-SPINK1 antibody

Sign In for Pricing
View Details
Rabbit Anti-SPINK1 antibody
SLM-60323R-02 100 µL

Rabbit Anti-SPINK1 antibody

Sign In for Pricing
View Details
RAD54L2 (ARIP4, HSPC325, SRISNF2L, RAD54 Like Protein 2) discontinued
219181-01 20 µL

RAD54L2 (ARIP4, HSPC325, SRISNF2L, RAD54 Like Protein 2) discontinued

Sign In for Pricing
View Details