Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASGR1/ASGPR1, Mouse (HEK293, His)

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ASGR1/ASGPR1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asgr1-asgpr1-protein-mouse-hek293-his.html

Purity

94.00

Smiles

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Molecular Formula

11889 (Gene_ID) P34927 (S60-N284) (Accession)

Molecular Weight

30-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COL9A2 (NM_001852) AAV Particle
RC223776A1V 250 µL

Human COL9A2 (NM_001852) AAV Particle

Sign In for Pricing
View Details
Mouse GM11435 siRNA
abx918078-01 15 nmol

Mouse GM11435 siRNA

Sign In for Pricing
View Details
Mouse GM11435 siRNA
abx918078-02 30 nmol

Mouse GM11435 siRNA

Sign In for Pricing
View Details
Lamin B1 (LMNB1) pThr575 rabbit polyclonal antibody, Serum
AP55052SU-N 200 µL

Lamin B1 (LMNB1) pThr575 rabbit polyclonal antibody, Serum

Sign In for Pricing
View Details
TRNAR20 Protein Lysate (Human) with C-Ha Tag
48342031 100 µg

TRNAR20 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Ephrin-b3 (EFNB3) Rabbit anti-Human Polyclonal Antibody
GWB-B741AA 0.05 mg

Ephrin-b3 (EFNB3) Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details