Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phospholipase D3 (Pld3)

Product Specifications

Product Name Alternative

Choline phosphatase 3 (Phosphatidylcholine-hydrolyzing phospholipase D3) (Schwannoma-associated protein 9) (SAM-9) (Sam9) (PLD 3)

Abbreviation

Recombinant Mouse Pld3 protein

Gene Name

Pld3

UniProt

O35405

Expression Region

1-488aa

Organism

Mus musculus (Mouse)

Target Sequence

MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRSFDTRYNQETPMEICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRRFWPAIDDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFVVPTDESQARIPYARVNHNKYMVTERASYIGTSNWSGSYFTETAGTSLLVTQNGHGGLRSQLEAVFLRDWESPYSHDLDTSANSVGNACRLL

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

58.2 kDa

References & Citations

"Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs." Okazaki Y., Furuno M., Kasukawa T., Adachi J., Bono H., Kondo S., Nikaido I., Osato N., Saito R., Suzuki H., Yamanaka I., Kiyosawa H., Yagi K., Tomaru Y., Hasegawa Y., Nogami A., Schonbach C., Gojobori T. Hayashizaki Y. Nature 420:563-573 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 Protein, Human, Recombinant (His Tag)
MBS8118593-01 0.1 mg

CD31 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
CD31 Protein, Human, Recombinant (His Tag)
MBS8118593-02 1 mg

CD31 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
CD31 Protein, Human, Recombinant (His Tag)
MBS8118593-03 5x 1 mg

CD31 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Lentiviral mouse Ldb3 shRNA (UAS) - Lentiviral mouse Ldb3 shRNA (UAS, iRFP) (25)
GTR15283598 1 Vial

Lentiviral mouse Ldb3 shRNA (UAS) - Lentiviral mouse Ldb3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Mterf 3'UTR Luciferase Stable Cell Line
TU213513 1.0 mL

Mterf 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
THUMPD2 Antibody - N-terminal region : FITC (ARP48937_P050-FITC)
ARP48937_P050-FITC 100 µL

THUMPD2 Antibody - N-terminal region : FITC (ARP48937_P050-FITC)

Sign In for Pricing
View Details