Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-4, Human (HEK293, His)

TIMP-4, a member of the tissue inhibitor of metalloproteinases family, forms complexes with metalloproteinases, including collagenases, and exerts irreversible inactivation by binding to their catalytic zinc cofactor. Its inhibitory effect is recognized on a range of metalloproteases, particularly MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9. TIMP-4 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-4-protein-human-hek-293-his.html

Purity

98.0

Smiles

CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

Molecular Formula

7079 (Gene_ID) Q99727 (C30-P224) (Accession)

Molecular Weight

Approximately 24.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Fructose-bisphosphate aldolase A,ALDOA ELISA KIT
ELI-04500Ra 96 Tests

Rabbit Fructose-bisphosphate aldolase A,ALDOA ELISA KIT

Sign In for Pricing
View Details
RPL35P2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1977804 1.0 µg DNA

RPL35P2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Dennd1b ORF Vector (Mouse) (pORF)
ORF042911 1.0 µg DNA

Dennd1b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SLAMF6 (SLAM family member 6) without tag for Antibody Discovery
MP1137X Each

Magic™ Membrane Protein Human SLAMF6 (SLAM family member 6) without tag for Antibody Discovery

Sign In for Pricing
View Details
Recombinant Human ErbB3 Protein, His, Insect-2ug
QP11803-2ug 2ug

Recombinant Human ErbB3 Protein, His, Insect-2ug

Sign In for Pricing
View Details
Rabbit anti-WDR42A  Antibody, Affinity Purified
A301-556A 20 µg

Rabbit anti-WDR42A Antibody, Affinity Purified

Sign In for Pricing
View Details