Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3 alpha (IIIc), Human (HEK293, His)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 alpha (IIIc) Protein, Human (HEK293, His) is the recombinant human-derived FGFR-3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 alpha (IIIc) Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-hek-293-his.html

Purity

98.0

Smiles

ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG

Molecular Formula

2261 (Gene_ID) P22607-1 (E23-G375) (Accession)

Molecular Weight

60-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gellan gum
YG153497-01 500 g

Gellan gum

Sign In for Pricing
View Details
Gellan gum
YG153497-02 1000 g

Gellan gum

Sign In for Pricing
View Details
Gellan gum
YG153497-03 2000 g

Gellan gum

Sign In for Pricing
View Details
Gellan gum
YG153497-04 5000 g

Gellan gum

Sign In for Pricing
View Details
Gellan gum
YG153497-05 10000 g

Gellan gum

Sign In for Pricing
View Details
PRKX Rabbit Polyclonal Antibody
E10G04321 100 µL

PRKX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details