Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdx1 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to Cdx1

Product Specifications

Product Name Alternative

Cdx, Cdx-1

UniProt

P18111

Reactivity

Mouse

Target

Cdx1

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: ERQVKIWFQNRRAKERKVNKKKQQQQQPLPPTQLPLPLDGTPTPSGPPLG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

28kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034010

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITM1 (Dolichyl-diphosphooligosaccharide--protein Glycosyltransferase Subunit STT3A, Oligosaccharyl Transferase Subunit STT3A, STT3-A, B5, Integral Membrane Protein 1, Transmembrane Protein TMC, FLJ27038, MGC9042) (MaxLight 750)
MBS6233491-01 0.1 mL

ITM1 (Dolichyl-diphosphooligosaccharide--protein Glycosyltransferase Subunit STT3A, Oligosaccharyl Transferase Subunit STT3A, STT3-A, B5, Integral Membrane Protein 1, Transmembrane Protein TMC, FLJ27038, MGC9042) (MaxLight 750)

Sign In for Pricing
View Details
ITM1 (Dolichyl-diphosphooligosaccharide--protein Glycosyltransferase Subunit STT3A, Oligosaccharyl Transferase Subunit STT3A, STT3-A, B5, Integral Membrane Protein 1, Transmembrane Protein TMC, FLJ27038, MGC9042) (MaxLight 750)
MBS6233491-02 5x 0.1 mL

ITM1 (Dolichyl-diphosphooligosaccharide--protein Glycosyltransferase Subunit STT3A, Oligosaccharyl Transferase Subunit STT3A, STT3-A, B5, Integral Membrane Protein 1, Transmembrane Protein TMC, FLJ27038, MGC9042) (MaxLight 750)

Sign In for Pricing
View Details
Anti-Human FOLH1/PSMA Monoclonal Monoclonal Antibody (1A098)
PTX24302 100 µg

Anti-Human FOLH1/PSMA Monoclonal Monoclonal Antibody (1A098)

Sign In for Pricing
View Details
Rabbit Anti Human KCND3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8424077-01 0.12 mL

Rabbit Anti Human KCND3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
Rabbit Anti Human KCND3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8424077-02 0.2 mL

Rabbit Anti Human KCND3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
Rabbit Anti Human KCND3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8424077-03 5x 0.2 mL

Rabbit Anti Human KCND3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details