Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Human (CHO, Fc)

4-1BB (CD137; TNFRSF9), a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily[1]. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment[2]. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells[3]. Human 4-1BB protein is a surface glycoprotein with a transmembrane domain (187-213 a.a.) . 4-1BB/TNFRSF9 Protein, Human (CHO, Fc) is the extracellular part (L24-Q186) of 4-1BB protein, produced by HEK293 cells with C-terminal hFc-tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Human (CHO, Fc), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Cancer-programmed cell death

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbr-tnfrsf9-protein-human-cho-fc.html

Purity

95.0

Smiles

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Molecular Formula

3604 (Gene_ID) Q07011 (L24-Q186) (Accession)

Molecular Weight

55-60 kDa

References & Citations

[1]Cheuk AT, et al. Role of 4-1BB:4-1BB ligand in cancer immunotherapy. Cancer Gene Ther. 2004 Mar;11 (3) :215-26.|[2]Ye L, et al. CD137, an attractive candidate for the immunotherapy of lung cancer. Cancer Sci. 2020 May;111 (5) :1461-1467.|[3]Jiang P, et al. CD137 promotes bone metastasis of breast cancer by enhancing the migration and osteoclast differentiation of monocytes/macrophages. Theranostics. 2019 May 9;9 (10) :2950-2966.|[4]Geng T, et al. CD137 Signaling Promotes Endothelial Apoptosis by Inhibiting Nrf2 Pathway, and Upregulating NF-κB Pathway. Mediators Inflamm. 2020 Jun 6;2020:4321912.|[5]Langstein J, et al. Comparative analysis of CD137 and LPS effects on monocyte activation, survival, and proliferation. Biochem Biophys Res Commun. 2000 Jun 24;273 (1) :117-22.|[6]Langstein J, et al. Identification of CD137 as a potent monocyte survival factor. J Leukoc Biol. 1999 Jun;65 (6) :829-33.|[7]Jiang D, et al. CD137 induces proliferation of murine hematopoietic progenitor cells and differentiation to macrophages. J Immunol. 2008 Sep 15;181 (6) :3923-32.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krtap24 (Krtap24-1) (NM_001163141) Mouse Tagged ORF Clone Lentiviral Particle
MR214405L4V 200 µL

Krtap24 (Krtap24-1) (NM_001163141) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal ITK Antibody [DyLight 550]
NBP2-32240R 0.1 mL

Rabbit Polyclonal ITK Antibody [DyLight 550]

Sign In for Pricing
View Details
P38 Mouse Monoclonal Antibody
AMM84956-01 1 Each

P38 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
P38 Mouse Monoclonal Antibody
AMM84956-02 50 µL

P38 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
P38 Mouse Monoclonal Antibody
AMM84956-03 100 µL

P38 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
RPRD1A Rabbit pAb (APR22438N)
APR22438N-01 50 µL

RPRD1A Rabbit pAb (APR22438N)

Sign In for Pricing
View Details