Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ilf2 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to Ilf2

Product Specifications

Product Name Alternative

Tex261, Tex267, TEG-267, 6230405A16Rik

UniProt

Q9CXY6

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Ilf2

Target

Ilf2

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: KRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSY

Field of Research

Epigenetics & Chromatin, Molecular Biology

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

42kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080650

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRO3/DTK, Mouse (HEK293, His)
HY-P77863 1 Each

TYRO3/DTK, Mouse (HEK293, His)

Sign In for Pricing
View Details
CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (AP)
MBS6486055-01 0.2 mL

CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (AP)

Sign In for Pricing
View Details
CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (AP)
MBS6486055-02 5x 0.2 mL

CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (AP)

Sign In for Pricing
View Details
Lentiviral human BTBD11 shRNA (UAS) - Lentiviral human BTBD11 shRNA (UAS) plasmid
GTR15330070 1 Vial

Lentiviral human BTBD11 shRNA (UAS) - Lentiviral human BTBD11 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (BSA & Azide Free) (MaxLight 550)
MBS6220135-01 0.1 mL

Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (BSA & Azide Free) (MaxLight 550)
MBS6220135-02 5x 0.1 mL

Thymidylate Synthase (dTMP synthase, TMS, TS, TSase, TYMS protein, Tyms thymidylate synthetase) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details