Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RON/MSPR, Human (HEK293, C-His)

RON/MSPR protein is a receptor tyrosine kinase that transduces signals by binding to MST1 ligand and regulates cell survival, migration, and differentiation. Ligand binding induces RON autophosphorylation, creating docking sites for downstream molecules. RON/MSPR Protein, Human (HEK293, C-His) is the recombinant human-derived RON/MSPR, expressed by HEK293, with C-10*His labeled tag.

Product Specifications

Product Name Alternative

RON/MSPR Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ron-mspr-protein-human-hek293-c-his.html

Purity

95.00

Smiles

EDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPGSWQQDHCPPKL

Molecular Formula

4486 (Gene_ID) Q04912 (E25-L571) (Accession)

Molecular Weight

Approximately 75-80 kDa, 40-43 kDa and 33-35 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-100 1x 100 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF640R conjugate, 0.1mg/mL
BNC401951-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (ICAM3/2873R), CF405S conjugate, 0.1mg/mL
BNC042873-100 1x 100 µL

CD50 / ICAM3 (ICAM3/2873R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF568 conjugate, 0.1mg/mL
BNC681893-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2786), CF568 conjugate, 0.1mg/mL
BNC682786-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2786), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF568 conjugate, 0.1mg/mL
BNC682075-100 1x 100 µL

MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details