Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RON/MSPR, Human (HEK293, C-His)

RON/MSPR protein is a receptor tyrosine kinase that transduces signals by binding to MST1 ligand and regulates cell survival, migration, and differentiation. Ligand binding induces RON autophosphorylation, creating docking sites for downstream molecules. RON/MSPR Protein, Human (HEK293, C-His) is the recombinant human-derived RON/MSPR, expressed by HEK293, with C-10*His labeled tag.

Product Specifications

Product Name Alternative

RON/MSPR Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ron-mspr-protein-human-hek293-c-his.html

Purity

95.00

Smiles

EDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPGSWQQDHCPPKL

Molecular Formula

4486 (Gene_ID) Q04912 (E25-L571) (Accession)

Molecular Weight

Approximately 75-80 kDa, 40-43 kDa and 33-35 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Spleen
CS804019 5x 5 µm

Tissue FFPE Sections, Spleen

Sign In for Pricing
View Details
ST18 Blocking Peptide
MBS8309425-01 1 mg

ST18 Blocking Peptide

Sign In for Pricing
View Details
ST18 Blocking Peptide
MBS8309425-02 5 mg

ST18 Blocking Peptide

Sign In for Pricing
View Details
ST18 Blocking Peptide
MBS8309425-03 5x 5 mg

ST18 Blocking Peptide

Sign In for Pricing
View Details
PTK2, Phosphorylated (Y861) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) (MaxLight 490)
MBS6434070-01 0.1 mL

PTK2, Phosphorylated (Y861) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) (MaxLight 490)

Sign In for Pricing
View Details
PTK2, Phosphorylated (Y861) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) (MaxLight 490)
MBS6434070-02 5x 0.1 mL

PTK2, Phosphorylated (Y861) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) (MaxLight 490)

Sign In for Pricing
View Details