Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIG/CXCL9, Mouse (HEK293, His)

CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis[1][2]. MIG/CXCL9 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags.

Product Specifications

Product Name Alternative

MIG/CXCL9 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl9-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT

Molecular Formula

17329 (Gene_ID) P18340 (T22-T126) (Accession)

Molecular Weight

Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Qiang Ding, et al. CXCL9: evidence and contradictions for its role in tumor progression. Cancer Med. 2016 Nov;5 (11) :3246-3259.|[2]Weigang Xiu, et al. CXCL9 secreted by tumor-associated dendritic cells up-regulates PD-L1 expression in bladder cancer cells by activating the CXCR3 signaling. BMC Immunol. 2021 Jan 6;22 (1) :3.|[3]Chao-Feng Lin, et al. Potential Effects of CXCL9 and CCL20 on Cardiac Fibrosis in Patients with Myocardial Infarction and Isoproterenol-Treated Rats. J Clin Med. 2019 May 11;8 (5) :659.|[4]Hui-Feng Gao, et al. CXCL9 chemokine promotes the progression of human pancreatic adenocarcinoma through STAT3-dependent cytotoxic T lymphocyte suppression. Aging (Albany NY) . 2020 Jan 8;12 (1) :502-517.|[5]Hacer Sahin, et al. Chemokine Cxcl9 attenuates liver fibrosis-associated angiogenesis in mice. Hepatology. 2012 May;55 (5) :1610-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL
BNC431050-500 1x 500 µL

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), Biotin conjugate, 0.1mg/mL
BNCB0177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF647 conjugate, 0.1mg/mL
BNC470385-100 1x 100 µL

CD3e (Rabbit PAb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details