Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-4/CCL18, Human

MIP-4/CCL18 Protein, Human is a CC chemokine ligand that binds to PITPNM3, GPR30 and CCR8 receptors and also acts as a neutral CCR3 antagonist mediating inflammation, autoimmunity and carcinogenesis. MIP-4/CCL18 Protein, Human is a recombinant human MIP-4/CCL18 (A21-A89) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MIP-4/CCL18 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-4-ccl18-protein-human.html

Purity

96.00

Smiles

AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Molecular Formula

6362 (Gene_ID) P55774 (A21-A89) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schutyser E, et al. Involvement of CC chemokine ligand 18 (CCL18) in normal and pathological processes. J Leukoc Biol. 2005 Jul;78 (1) :14-26.|[2]K Hieshima, et al. A novel human CC chemokine PARC that is most homologous to macrophage-inflammatory protein-1 alpha/LD78 alpha and chemotactic for T lymphocytes, but not for monocytes. J Immunol. 1997 Aug 1;159 (3) :1140-9.|[3]Sabina A Islam, et al. Identification of human CCR8 as a CCL18 receptor. J Exp Med. 2013 Sep 23;210 (10) :1889-98.|[4]Ling Lin, et al. CCL18 from tumor-associated macrophages promotes angiogenesis in breast cancer. Oncotarget. 2015 Oct 27;6 (33) :34758-73.|[5]Xiaoqiang Liu, et al. CCL18 enhances migration, invasion and EMT by binding CCR8 in bladder cancer cells. Mol Med Rep. 2019 Mar;19 (3) :1678-1686.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GON7 Antibody - C-terminal region : HRP (ARP69018_P050-HRP)
ARP69018_P050-HRP 100 µL

GON7 Antibody - C-terminal region : HRP (ARP69018_P050-HRP)

Sign In for Pricing
View Details
AH057
orb1738176-01 25 mg

AH057

Sign In for Pricing
View Details
AH057
orb1738176-02 50 mg

AH057

Sign In for Pricing
View Details
AH057
orb1738176-03 100 mg

AH057

Sign In for Pricing
View Details
ARK5 Polyclonal Antibody, Cy5 Conjugated
bs-6251R-Cy5 100 µL

ARK5 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
PTPN5 Recombinant Protein
OPCD00393-50UG 50 µg

PTPN5 Recombinant Protein

Sign In for Pricing
View Details