Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2J2, Human (GST)

The UBE2J2 protein plays a crucial role in cellular processes by catalyzing the covalent attachment of ubiquitin to other proteins. Its function is involved in the selective degradation of misfolded membrane proteins extending into the endoplasmic reticulum (ERAD), as suggested by the similarity of related processes. UBE2J2 Protein, Human (GST) is the recombinant human-derived UBE2J2 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UBE2J2 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2j2-protein-human-gst.html

Smiles

EKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANR

Molecular Formula

118424 (Gene_ID) Q8N2K1-1 (E124-R224) (Accession)

Molecular Weight

Approximately 30 kDa & 36 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fhl1 activation kit by CRISPRa
GA201418 1 Kit

Mouse Fhl1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human EDG8 (S1PR5) activation kit by CRISPRa
GA110021 1 Kit

Human EDG8 (S1PR5) activation kit by CRISPRa

Sign In for Pricing
View Details
1,2,3,4,5,6-Benzenehexamine Trihydrochloride
TRC-B189905-50MG 50 mg

1,2,3,4,5,6-Benzenehexamine Trihydrochloride

Sign In for Pricing
View Details
all-cis-4,7,10,13,16-Docosapentaenoic Acid
TRC-A014954-2.5MG 2.5 mg

all-cis-4,7,10,13,16-Docosapentaenoic Acid

Sign In for Pricing
View Details
Gemin 1 Recombinant Rabbit Monoclonal Antibody [JG38-19]
ET7108-63 100 µL

Gemin 1 Recombinant Rabbit Monoclonal Antibody [JG38-19]

Sign In for Pricing
View Details
Tissue FFPE Sections, Cecum
CS712826 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details