Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2J2, Human (GST)

The UBE2J2 protein plays a crucial role in cellular processes by catalyzing the covalent attachment of ubiquitin to other proteins. Its function is involved in the selective degradation of misfolded membrane proteins extending into the endoplasmic reticulum (ERAD), as suggested by the similarity of related processes. UBE2J2 Protein, Human (GST) is the recombinant human-derived UBE2J2 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UBE2J2 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2j2-protein-human-gst.html

Smiles

EKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANR

Molecular Formula

118424 (Gene_ID) Q8N2K1-1 (E124-R224) (Accession)

Molecular Weight

Approximately 30 kDa & 36 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCAR2 Antibody
KC-6063-01 50 μL

CCAR2 Antibody

Sign In for Pricing
View Details
CCAR2 Antibody
KC-6063-02 100 µL

CCAR2 Antibody

Sign In for Pricing
View Details
CCAR2 Antibody
KC-6063-03 1 mL

CCAR2 Antibody

Sign In for Pricing
View Details
FE65 (APBB1) (NM_001164) Human Over-expression Lysate
LC400467 20 µg

FE65 (APBB1) (NM_001164) Human Over-expression Lysate

Sign In for Pricing
View Details
PCOLCE (NM_002593) Human Over-expression Lysate
LC419210 20 µg

PCOLCE (NM_002593) Human Over-expression Lysate

Sign In for Pricing
View Details
Hexyl Chloroformate
TRC-H295700-1G 1 g

Hexyl Chloroformate

Sign In for Pricing
View Details