Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX25 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to DDX25

Product Specifications

Product Name Alternative

GRTH

UniProt

Q9UHL0

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDX25

Target

DDX25

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

41kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TP53 (Tumor Suppressor p53, Cellular Tumor Antigen p53, TRP53, Antigen NY-CO-13, BCC7, LFS1, Phosphoprotein p53) (PE) discontinued
138458-PE 100 µL

TP53 (Tumor Suppressor p53, Cellular Tumor Antigen p53, TRP53, Antigen NY-CO-13, BCC7, LFS1, Phosphoprotein p53) (PE) discontinued

Sign In for Pricing
View Details
PpsR Antibody
orb824839 2 mg

PpsR Antibody

Sign In for Pricing
View Details
SCN3A (Sodium Channel Protein Type 3 Subunit alpha, Sodium Channel Protein Brain III Subunit alpha, Sodium Channel Protein Type III Subunit alpha, Voltage-gated Sodium Channel Subtype III, Voltage-gated Sodium Channel Subunit alpha Nav1.3, KIAA1356, NAC3)
MBS6213845-01 0.1 mL

SCN3A (Sodium Channel Protein Type 3 Subunit alpha, Sodium Channel Protein Brain III Subunit alpha, Sodium Channel Protein Type III Subunit alpha, Voltage-gated Sodium Channel Subtype III, Voltage-gated Sodium Channel Subunit alpha Nav1.3, KIAA1356, NAC3)

Sign In for Pricing
View Details
SCN3A (Sodium Channel Protein Type 3 Subunit alpha, Sodium Channel Protein Brain III Subunit alpha, Sodium Channel Protein Type III Subunit alpha, Voltage-gated Sodium Channel Subtype III, Voltage-gated Sodium Channel Subunit alpha Nav1.3, KIAA1356, NAC3)
MBS6213845-02 5x 0.1 mL

SCN3A (Sodium Channel Protein Type 3 Subunit alpha, Sodium Channel Protein Brain III Subunit alpha, Sodium Channel Protein Type III Subunit alpha, Voltage-gated Sodium Channel Subtype III, Voltage-gated Sodium Channel Subunit alpha Nav1.3, KIAA1356, NAC3)

Sign In for Pricing
View Details
U2AF2, NT (U2AF2, U2AF65, Splicing factor U2AF 65kD subunit, U2 auxiliary factor 65kD subunit, U2 snRNP auxiliary factor large subunit) (PE)
MBS6360496-01 0.2 mL

U2AF2, NT (U2AF2, U2AF65, Splicing factor U2AF 65kD subunit, U2 auxiliary factor 65kD subunit, U2 snRNP auxiliary factor large subunit) (PE)

Sign In for Pricing
View Details
U2AF2, NT (U2AF2, U2AF65, Splicing factor U2AF 65kD subunit, U2 auxiliary factor 65kD subunit, U2 snRNP auxiliary factor large subunit) (PE)
MBS6360496-02 5x 0.2 mL

U2AF2, NT (U2AF2, U2AF65, Splicing factor U2AF 65kD subunit, U2 auxiliary factor 65kD subunit, U2 snRNP auxiliary factor large subunit) (PE)

Sign In for Pricing
View Details